Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Chicken Liver Crostini

Seared chicken livers with butter, sage, and a splash of Marsala folded into a silky spread, served on crispy bread. Classic Italian simplicity that tastes like a trattoria.

Total time
18 min
Servings
2
Calories
380
Protein
18g
Creamy Chicken Liver Crostini
elegantrusticitalianchickencreamycrispyweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice baguette diagonally into 0.5-inch-thick pieces. Brush lightly with oil on both sides, arrange on a sheet pan, and toast at 400°F until golden, about 5 minutes.

  2. Step 2

    Pat chicken livers dry with paper towels. Season generously with salt and pepper.

  3. Step 3

    Heat 2 tbsp butter in a skillet over medium-high until foaming. Add livers in a single layer and sear without moving for 2 minutes until golden on bottom.

  4. Step 4

    Flip livers, add sage and minced shallot, and cook 90 seconds more until centers feel barely firm when pressed.

  5. Step 5

    Pour in Marsala, scraping up browned bits, and simmer 1 minute until liquid reduces slightly.

  6. Step 6

    Remove from heat. Mash livers coarsely with a fork, then stir in remaining 1 tbsp butter until creamy. Spread on warm toasted bread and serve immediately.

Tools you’ll need

  • sheet pan
  • 12-inch skillet
  • chef's knife
  • fork or wooden spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.