Custrd is out on the App Store — Download it free →
Back to recipes

Chicken with Polenta

Comforting braised chicken legs served over creamy polenta, finished with fresh parsley. A simple, hearty meal that comes together in one pot.

Total time
55 min
Servings
4
Calories
520
Protein
32g
Chicken with Polenta
comfortingheartyItaliangluten-freechickencreamytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Season the 4 chicken legs with 1/2 tsp salt. Heat 2 tbsp olive oil in a large pot over medium-high heat.

  2. Step 2

    Add the chicken legs skin-side down and cook until golden brown, about 5 minutes per side. Remove and set aside.

  3. Step 3

    Reduce heat to medium. Add 1 sliced onion and 2 minced garlic cloves, cook until soft, about 4 minutes.

  4. Step 4

    Pour in 3 cups chicken broth, scraping up any browned bits. Return the chicken to the pot, bring to a simmer.

  5. Step 5

    Cover and simmer gently until chicken is tender and cooked through, about 30 minutes. Remove chicken and keep warm.

  6. Step 6

    Whisk 1 cup polenta into the simmering broth. Cook, stirring often, until thick and creamy, about 15 minutes.

  7. Step 7

    Season polenta with remaining 1/2 tsp salt. Serve chicken over polenta, garnished with 1/4 cup chopped parsley.

  8. Step 8

    Let rest 5 minutes before serving.

Tools you’ll need

  • large pot with lid
  • whisk
  • measuring cups and spoons
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.