Custrd is out on the App Store — Download it free →
Back to recipes

Chickpea Breakfast Bowl

A quick, savory breakfast bowl with warm chickpeas, creamy yogurt, and a crunchy topping. Ready in minutes and full of protein to start your day.

Total time
20 min
Servings
2
Calories
350
Protein
15g
Chickpea Breakfast Bowl
comfortingmiddle easternvegetarianchickpeacreamycrunchyweekdaybowl

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Drain and rinse the 1 can chickpeas. Pat dry with a towel. Heat 1 tbsp olive oil in a skillet over medium-high heat.

  2. Step 2

    Add chickpeas to the skillet. Cook, shaking occasionally, until they start to brown and crisp, about 8 minutes. Stir in 1 tsp cumin and a pinch of salt.

  3. Step 3

    Meanwhile, tear the 1 pita into bite-size pieces. Toast in a dry skillet over medium heat until golden and crunchy, about 3 minutes.

  4. Step 4

    Spread the 1 cup yogurt onto a plate or bowl. Top with the warm chickpeas, toasted pita, and 1 tbsp olive oil.

  5. Step 5

    Chop the 0.25 cup parsley and sprinkle over the bowl. Season with salt and pepper. Serve immediately.

Tools you’ll need

  • skillet
  • colander
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.