Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chickpea Buddha Bowl with Tahini Drizzle

Warm grains, roasted chickpeas, and fresh vegetables topped with a creamy tahini sauce. Ready in 25 minutes with zero chopping fuss.

Total time
25 min
Servings
2
Calories
385
Protein
12g
Chickpea Buddha Bowl with Tahini Drizzle
wholesomequickmediterraneanvegetarianveganchickpeascrispycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Pat chickpeas very dry with paper towels.

  2. Step 2

    Toss chickpeas with 1 tbsp olive oil, salt, and pepper. Spread on a baking sheet.

  3. Step 3

    Roast chickpeas 12–15 minutes, shaking halfway through, until edges are crispy.

  4. Step 4

    Whisk tahini, lemon juice, 2 tbsp water, salt, and pepper until pourable.

  5. Step 5

    Divide warm rice between two bowls. Arrange tomatoes and cucumber alongside.

  6. Step 6

    Top with roasted chickpeas. Drizzle tahini sauce over the entire bowl.

Tools you’ll need

  • baking sheet
  • paper towels
  • small bowl
  • whisk
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.