Back to recipes
Chili Crisp Avocado Toast with Everything
Creamy smashed avocado on crispy toast, topped with chili crisp, everything seasoning, and a squeeze of lime. Potato chips on the side make it a proper snack.
- Total time
- 5 min
- Servings
- 1
- Calories
- 280
- Protein
- 7g
quicksatisfyingcalifornianvegetarianvegancrispycreamysnack
Ingredients
6 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Toast the bread until golden brown and crispy, 2–3 minutes.
Step 2
Scoop the avocado onto the toast and smash it with the back of a fork until chunky-creamy.
Step 3
Drizzle chili crisp over the avocado, then sprinkle everything seasoning on top.
Step 4
Squeeze lime juice over the toast and serve with a handful of potato chips on the side.
Tools you’ll need
- toaster or toaster oven
- fork
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
