Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chili Crisp Pork with Green Beans

Pad Prik King stripped down to its essence: pork belly stir-fried with green beans, garlic, and a punchy chili-oil sauce that tastes like a restaurant version. Ready in 18 minutes flat.

Total time
18 min
Servings
2
Calories
385
Protein
28g
Chili Crisp Pork with Green Beans
quicksatisfyingthaiporkcrispytenderweeknightstir-fry

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. Step 2

    Add pork pieces and cook without stirring until edges brown, 3–4 minutes; stir and cook 2 more minutes until no pink remains.

  3. Step 3

    Add minced garlic and curry paste, stir constantly until fragrant, about 30 seconds.

  4. Step 4

    Add green beans, chili crisp, and fish sauce; toss to coat and cook until beans are just tender-crisp, 4–5 minutes.

  5. Step 5

    Taste and adjust seasoning with more fish sauce or chili crisp if needed.

  6. Step 6

    Serve hot over jasmine rice or with sticky rice on the side.

Tools you’ll need

  • 12-inch skillet with a lid
  • cutting board and knife
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.