Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chili Crisp Pork Pad Prik King

Tender pork seared with long beans in a spicy-herbal red curry paste sauce, finished with a swirl of chili crisp. Pure TikTok magic in one skillet, 20 minutes flat.

Total time
20 min
Servings
2
Calories
385
Protein
32g
Chili Crisp Pork Pad Prik King
satisfyingboldthaiporktendercrispyweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a 12-inch skillet over medium-high until shimmering.

  2. Step 2

    Add pork, spread in a single layer, don't stir for 2 minutes until edges brown.

  3. Step 3

    Stir, break into smaller pieces, cook 2 more minutes until no pink remains.

  4. Step 4

    Stir in red curry paste, cook 1 minute until fragrant and the paste darkens.

  5. Step 5

    Add long beans and coconut milk, toss to coat, simmer 5 minutes until beans are tender-crisp.

  6. Step 6

    Squeeze lime juice over the top, stir in basil, drizzle with chili crisp, serve immediately.

Tools you’ll need

  • 12-inch stainless steel or cast-iron skillet
  • wooden spoon or silicone spatula
  • cutting board
  • chef's knife
  • microplane or box grater (for lime zest, optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.