Custrd is out on the App Store — Download it free →
Back to recipes

Chinese Garlic Eggplant

Tender eggplant stir-fried with fragrant garlic, soy sauce, and a touch of sesame oil. A classic vegetarian dish with bold, savory flavors and a silky texture.

Total time
25 min
Servings
4
Calories
156
Protein
2g
Chinese Garlic Eggplant
chinesevegetarianstir-fryeggplantgarlicquick dinnervegan

Ingredients

11 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut eggplant into 2-inch cubes. Toss with 0.5 tsp salt and let sit for 10 minutes to draw out moisture.

  2. Step 2

    Pat eggplant dry with paper towels. Mince garlic and ginger separately.

  3. Step 3

    Heat 2 tbsp vegetable oil in a 14-inch wok or large skillet over high heat until shimmering.

  4. Step 4

    Working in batches, cook eggplant until golden and tender, about 4-5 minutes per batch. Transfer to a plate.

  5. Step 5

    Add remaining 1 tbsp oil to the wok. Add garlic, ginger, and chili flakes. Cook for 30 seconds until fragrant.

  6. Step 6

    Return eggplant to wok. Add soy sauce, rice vinegar, and sugar. Toss to coat.

  7. Step 7

    Drizzle with sesame oil and toss gently until combined.

  8. Step 8

    Transfer to serving plate. Garnish with green onion and sesame seeds. Serve immediately over rice.

Tools you’ll need

  • 14-inch wok or large skillet
  • sharp knife
  • cutting board
  • paper towels
  • wooden spoon or wok turner
  • measuring spoons
  • small bowl for sauce

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.