Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chipotle-Honey Salmon with Pesto Pasta

Salmon fillets glazed with smoky chipotle and honey, baked until flaky, served alongside quick pesto pasta and roasted potatoes. Ready in under 20 minutes.

Total time
20 min
Servings
2
Calories
340
Protein
38g
Chipotle-Honey Salmon with Pesto Pasta
quicksatisfyingamericansalmonflakytenderweeknightmain-dish

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F and line a sheet pan with parchment paper.

  2. Step 2

    Pat salmon fillets dry and arrange skin-side down on the sheet pan.

  3. Step 3

    Stir chipotle peppers, honey, and lime juice in a small bowl until combined.

  4. Step 4

    Spread the chipotle glaze evenly over the salmon fillets.

  5. Step 5

    Bake for 12–14 minutes until the flesh flakes easily with a fork.

  6. Step 6

    Serve hot with pesto pasta, roasted potatoes, and lime wedges.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • oven
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.