Back to recipes
Sweet Chili Salmon with Lime
Glazed salmon with sweet chili sauce and a squeeze of lime, baked until flaky in under 20 minutes. Serve with mashed potatoes, sautéed spinach, and roasted peppers for a complete weeknight dinner.
- Total time
- 18 min
- Servings
- 2
- Calories
- 320
- Protein
- 36g
simplequickamericansalmonflakytenderweeknightmain-dish
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Preheat oven to 400°F and line a sheet pan with parchment paper.
Step 2
Pat salmon dry and place skin-side down on the pan, then brush with sweet chili sauce.
Step 3
Bake salmon for 12–14 minutes until flesh flakes easily with a fork.
Step 4
Squeeze fresh lime juice over the baked salmon just before serving.
Tools you’ll need
- sheet pan
- parchment paper
- pastry brush
- oven
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
