Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chocolate Croissant Toast

Store-bought croissants split, filled with dark chocolate, and crisped in a skillet until the chocolate melts and edges turn golden. A 5-minute French breakfast that tastes indulgent but requires zero baking.

Total time
5 min
Servings
2
Calories
315
Protein
4g
Chocolate Croissant Toast
indulgentquickfrenchvegetariancrispymeltybreakfastweekend

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Split each croissant horizontally, being careful not to tear the sides. Divide chocolate evenly between the four halves.

  2. Step 2

    Melt butter in a skillet over medium heat. Once foaming, place the four croissant halves chocolate-side up in the pan.

  3. Step 3

    Cook for 2-3 minutes without moving until the bottom is golden and the chocolate starts to soften.

  4. Step 4

    Transfer to a plate. Sprinkle with fleur de sel, then dust with powdered sugar.

  5. Step 5

    Serve immediately while the chocolate is still warm and melted.

Tools you’ll need

  • chef's knife
  • 10-inch nonstick skillet or cast iron
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.