Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Classic Apple Tarte Tatin

Buttery caramelized apples under a golden puff pastry crust, flipped to reveal a glossy, amber topping. A rustic French dessert that looks impressive but takes just 45 minutes start to finish.

Total time
45 min
Servings
6
Calories
385
Protein
3g
Classic Apple Tarte Tatin
elegantindulgentfrenchvegetariancrispytendercaramelizeddate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Pat apple halves dry with paper towels.

  2. Step 2

    In a 10-inch cast iron skillet, melt butter over medium-high heat, ~2 minutes.

  3. Step 3

    Add sugar and salt, stirring often, until caramel is amber and fragrant, ~4 minutes.

  4. Step 4

    Remove from heat. Arrange apple halves cut-side down in a tight spiral, fitting them snugly.

  5. Step 5

    Return to medium heat and cook apples without moving until caramel darkens, ~5 minutes.

  6. Step 6

    Drizzle vanilla extract over apples. Remove from heat and cool 2 minutes.

  7. Step 7

    Lay puff pastry over apples, tucking edges down inside the skillet rim.

  8. Step 8

    Bake until pastry is puffed and golden brown, 18–22 minutes.

  9. Step 9

    Cool 5 minutes. Run a thin knife around the edge, then invert onto a serving plate in one quick motion.

  10. Step 10

    Serve warm or at room temperature, ideally with crème fraîche or vanilla ice cream.

Tools you’ll need

  • 10-inch cast iron skillet
  • wooden spoon or heatproof spatula
  • measuring cups and spoons
  • paper towels
  • oven
  • thin-bladed knife
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.