Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Classic Tuna Melt

Crispy bread, melted cheese, and warm tuna salad come together in this timeless American sandwich. Ready in 15 minutes.

Total time
15 min
Servings
2
Calories
485
Protein
28g
Classic Tuna Melt
comfortcasualamericanfishcrispymeltytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Open the can of tuna and pour it into a fine-mesh strainer held over a bowl or sink; press gently with the back of a fork to squeeze out as much liquid as possible.

  2. Step 2

    Transfer the drained tuna to a small bowl and stir in 3 tablespoons of mayonnaise, a pinch of salt, and a pinch of pepper until evenly combined.

  3. Step 3

    Spread half of the tuna mixture (about 2.5 tablespoons) onto the top surface of two bread slices, dividing evenly between them.

  4. Step 4

    Place one cheese slice on top of the tuna on each sandwich, laying it flat so it covers the tuna completely.

  5. Step 5

    Top each sandwich with a second bread slice, pressing down gently so the slices adhere.

  6. Step 6

    Place a 12-inch skillet over medium-high heat and add 1 tablespoon of butter, tilting the pan so the butter melts and coats the bottom evenly, about 45 seconds.

  7. Step 7

    Once the butter stops foaming and smells nutty, carefully lay both sandwiches flat in the skillet without overlapping.

  8. Step 8

    Cook the first side without moving the sandwiches until the bread turns the color of warm honey and feels firm when you press the edge with your spatula, about 3 minutes.

  9. Step 9

    Remove the skillet from heat and add the remaining 1 tablespoon of butter, tilting to coat the hot surface.

  10. Step 10

    Use a thin spatula to slide underneath one sandwich and flip it onto the buttered surface; repeat with the second sandwich.

  11. Step 11

    Return the skillet to medium-high heat and cook the second side until the bread turns golden honey-brown and the cheese inside is melted (peek at the edge to check), about 2 to 3 minutes.

  12. Step 12

    Slide both sandwiches onto a cutting board or serving plate and let them rest for 1 minute before eating so the cheese sets slightly.

Tools you’ll need

  • 12-inch skillet
  • fine-mesh strainer
  • small bowl
  • fork
  • thin metal spatula
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.