Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Coconut Laksa with Shrimp

Creamy, spicy coconut broth loaded with tender shrimp and noodles. Laksa paste does the heavy lifting—just add coconut milk, broth, and seafood.

Total time
20 min
Servings
2
Calories
420
Protein
28g
Coconut Laksa with Shrimp
comfortboldthaishrimpcreamytenderweeknightsoup

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of salted water to boil. Add noodles and cook until just tender, ~4 minutes. Drain and set aside.

  2. Step 2

    In the same pot, heat 1 tbsp oil over medium-high. Add laksa paste and cook, stirring, until fragrant, ~1 minute.

  3. Step 3

    Pour in coconut milk and broth, stirring to break up the paste. Bring to a gentle simmer.

  4. Step 4

    Add shrimp and cook until pink and cooked through, 3–4 minutes. Do not stir constantly; let them sear lightly.

  5. Step 5

    Squeeze lime juice into the broth. Taste and adjust with salt and more lime as needed.

  6. Step 6

    Divide noodles between bowls, ladle broth and shrimp over top, and scatter green onions on the surface.

Tools you’ll need

  • large pot
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.