Custrd is out on the App Store — Download it free →
Back to recipes

Cod with Potatoes and Vegetables

A quick and colorful one-pan meal featuring flaky cod, roasted potatoes, and tender vegetables, finished with a squeeze of lemon and a drizzle of red sauce.

Total time
30 min
Servings
4
Calories
350
Protein
30g
Cod with Potatoes and Vegetables
comfortingPortuguese-inspiredgluten-freefishflakytenderweeknightmain course

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Halve the 1 lb baby potatoes and toss with 1 tbsp olive oil, salt, and pepper on a baking sheet. Roast for 10 minutes.

  2. Step 2

    Add the 2 cups mixed vegetables to the sheet, toss with 1 tbsp olive oil, and roast for 10 more minutes until potatoes are tender and veggies are crisp-tender.

  3. Step 3

    Season the 1 lb cod fillets with salt and pepper. Push vegetables to one side, place cod on the sheet, drizzle with remaining 1 tbsp olive oil, and roast for 8-10 minutes until fish flakes easily.

  4. Step 4

    Warm the 0.5 cup red sauce in a small saucepan over medium heat, about 3 minutes, until steaming.

  5. Step 5

    Serve cod and vegetables with a squeeze of lemon and a spoonful of red sauce on top.

Tools you’ll need

  • baking sheet
  • small saucepan
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.