Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Com Chien (Vietnamese Fried Rice)

A vibrant Vietnamese fried rice loaded with shrimp, chicken, and eggs, finished with fish sauce and fresh herbs. Ready in under 30 minutes with day-old rice.

Total time
25 min
Servings
4
Calories
385
Protein
28g
Com Chien (Vietnamese Fried Rice)
quicksatisfyingvietnameseshrimpchickeneggsfluffytender

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a 14-inch wok or large skillet over high heat until it shimmers, ~90 seconds.

  2. Step 2

    Add shrimp and cook without stirring for 90 seconds, then flip and cook 90 seconds more until pink.

  3. Step 3

    Transfer shrimp to a plate. Add remaining 2 tbsp oil to the wok.

  4. Step 4

    Pour in beaten eggs, stirring constantly until large curds form, ~2 minutes. Transfer to the plate with shrimp.

  5. Step 5

    Add garlic and stir-fry for 30 seconds until fragrant, then add peas, carrots, and diced chicken.

  6. Step 6

    Add chilled rice, breaking up any clumps with a wooden spoon. Toss constantly for 2–3 minutes.

  7. Step 7

    Pour fish sauce over rice and toss for 1 minute until the color is even and aromatic.

  8. Step 8

    Return shrimp and eggs to the wok. Toss gently to combine, ~30 seconds.

  9. Step 9

    Divide among bowls and top with green onions and cilantro. Serve hot.

Tools you’ll need

  • 14-inch wok or large skillet
  • wooden spoon or wok turner
  • cutting board
  • chef's knife
  • small bowl
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.