CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Cơm Rang Thập Cẩm (Vietnamese Mixed Fried Rice)

A vibrant one-pan fried rice loaded with shrimp, chicken, and vegetables in a lightly caramelized soy-and-fish-sauce glaze. Ready in 20 minutes, perfect for weeknight dinners.

Total time
25 min
Servings
4
Calories
385
Protein
28g
Cơm Rang Thập Cẩm (Vietnamese Mixed Fried Rice)
quicksatisfyingvietnameseshrimpchickenfluffytenderweeknight

Ingredients

  • 3 cups cooked jasmine rice, day-old or cooled
  • ½ lb shrimp, peeled and deveined
  • ½ lb chicken breast, diced small
  • 1 cup mixed vegetables (peas, carrots, corn)
  • 2 tbsp fish sauce
  • 1 tbsp soy sauce
  • 3 cloves garlic, minced

Instructions

  1. 1

    Heat 2 tbsp oil in a 12-inch skillet over medium-high until it shimmers, about 1 minute.

  2. 2

    Add garlic and cook, stirring, until fragrant, about 30 seconds.

  3. 3

    Add shrimp and diced chicken, stirring often, until cooked through, 4–5 minutes.

  4. 4

    Add rice and vegetables, breaking up any clumps. Stir constantly for 2 minutes.

  5. 5

    Pour fish sauce and soy sauce over rice. Toss until evenly coated and heated through, 1–2 minutes.

  6. 6

    Taste and adjust seasoning with salt and pepper. Serve hot.

Tools you’ll need

  • 12-inch skillet or wok
  • wooden spoon or spatula
  • measuring spoons
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.