Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cơm Rang Thập Cẩm (Vietnamese Mixed Fried Rice)

A vibrant one-pan fried rice loaded with shrimp, chicken, and vegetables in a lightly caramelized soy-and-fish-sauce glaze. Ready in 20 minutes, perfect for weeknight dinners.

Total time
25 min
Servings
4
Calories
385
Protein
28g
Cơm Rang Thập Cẩm (Vietnamese Mixed Fried Rice)
quicksatisfyingvietnameseshrimpchickenfluffytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a 12-inch skillet over medium-high until it shimmers, about 1 minute.

  2. Step 2

    Add garlic and cook, stirring, until fragrant, about 30 seconds.

  3. Step 3

    Add shrimp and diced chicken, stirring often, until cooked through, 4–5 minutes.

  4. Step 4

    Add rice and vegetables, breaking up any clumps. Stir constantly for 2 minutes.

  5. Step 5

    Pour fish sauce and soy sauce over rice. Toss until evenly coated and heated through, 1–2 minutes.

  6. Step 6

    Taste and adjust seasoning with salt and pepper. Serve hot.

Tools you’ll need

  • 12-inch skillet or wok
  • wooden spoon or spatula
  • measuring spoons
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.