Back to recipes
Cottage Cheese Tuna Wrap
A no-cook tuna salad made creamy with cottage cheese and punchy with mustard, stuffed into a wrap with fresh celery. Ready in 5 minutes.
- Total time
- 5 min
- Servings
- 1
- Calories
- 180
- Protein
- 28g
quickfreshamericangluten-freefishcreamycrispweeknight
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Mix drained tuna, cottage cheese, and mustard in a bowl until combined.
Step 2
Fold in diced celery until evenly distributed.
Step 3
Spread the tuna salad onto a wrap and roll tightly.
Step 4
Serve immediately or wrap in foil for later.
Tools you’ll need
- small bowl
- spoon
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
