Cottage Cheese Tuna Wrap
A no-cook tuna salad made creamy with cottage cheese and punchy with mustard, stuffed into a wrap with fresh celery. Ready in 5 minutes.
- Total time
- 5 min
- Servings
- 1
- Calories
- 180
- Protein
- 28g

quickfreshamericangluten-freefishcreamycrispweeknight
Ingredients
- 1 can (5 oz), drained canned tuna
- ½ cup cottage cheese
- ½ stalk, diced celery
- 1 tbsp mustard
Instructions
- 1
Mix drained tuna, cottage cheese, and mustard in a bowl until combined.
- 2
Fold in diced celery until evenly distributed.
- 3
Spread the tuna salad onto a wrap and roll tightly.
- 4
Serve immediately or wrap in foil for later.
Tools you’ll need
- small bowl
- spoon
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



