Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crawfish Monica

Cajun-spiced crawfish and pasta in a rich, buttery cream sauce with onions and garlic. A New Orleans classic that's elegant enough for company but simple enough for a weeknight dinner.

Total time
35 min
Servings
4
Calories
720
Protein
38g
Crawfish Monica
comfortelegantcajuncrawfishcreamytenderweeknightdate-night

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large pot. Add pasta and cook until al dente, ~8 minutes. Drain and set aside.

  2. Step 2

    Pat crawfish dry with paper towels. This prevents splattering.

  3. Step 3

    Melt butter in a 12-inch skillet over medium-high heat until foaming, ~1 minute.

  4. Step 4

    Add diced onion. Sauté until softened and edges begin to brown, ~4 minutes.

  5. Step 5

    Stir in garlic and cajun seasoning. Cook until fragrant, ~30 seconds.

  6. Step 6

    Add crawfish tails. Cook, stirring occasionally, until opaque, ~4 minutes.

  7. Step 7

    Pour in cream. Stir to combine and simmer until sauce thickens slightly, ~2 minutes.

  8. Step 8

    Add cooked pasta to the skillet. Toss until coated and heated through, ~1 minute.

  9. Step 9

    Taste and adjust seasoning with salt and pepper.

  10. Step 10

    Divide among four bowls and serve hot.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • colander
  • wooden spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.