Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Creamy Chicken Empadão

Brazilian chicken hand pie, reimagined as a quick skillet filling with puff pastry. Creamy, savory, ready in 20 minutes—no rolling dough required.

Total time
20 min
Servings
4
Calories
520
Protein
32g
20-Min Creamy Chicken Empadão
comfortcasualbrazilianchickencreamyflakytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a 10-inch skillet over medium. Add cream cheese and let it soften, stirring occasionally, about 90 seconds.

  2. Step 2

    Stir in shredded chicken, frozen peas and carrots, and cheddar. Cook until vegetables are warm and cheese melts, ~3 minutes.

  3. Step 3

    Transfer filling to a shallow baking dish or leave in skillet if oven-safe. Season with salt and pepper to taste.

  4. Step 4

    Unfold puff pastry sheets and lay over filling, pressing edges down gently. Whisk egg and brush over pastry.

  5. Step 5

    Broil on high for 4–5 minutes until pastry is golden brown and puffed. Watch carefully to avoid burning.

  6. Step 6

    Remove from heat. Scatter cilantro over top and let rest 2 minutes. Serve warm.

Tools you’ll need

  • 10-inch skillet
  • shallow baking dish (or oven-safe skillet)
  • broiler
  • small bowl (for egg wash)
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.