Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Empadão de Frango

A Brazilian hand pie filled with seasoned shredded chicken, palm hearts, and olives in a rich cream sauce. Baked until golden, it's comfort food that comes together in under 30 minutes.

Total time
28 min
Servings
4
Calories
612
Protein
28g
Quick Empadão de Frango
comfortcasualbrazilianchickentendercreamycrispyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 400°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. Step 2

    Drain the canned palm hearts in a colander; discard the liquid. Slice each palm heart lengthwise into thin strips, about 1/4-inch thick.

  3. Step 3

    Slice the pitted green olives crosswise into thin rings, about 1/8-inch thick.

  4. Step 4

    In a medium saucepan over medium heat, pour in the heavy cream and bring it to a gentle simmer, stirring once every 30 seconds, about 3 minutes. You'll see small bubbles form around the edges.

  5. Step 5

    Add the shredded chicken to the hot cream and stir continuously until the chicken is heated through and the mixture is uniform, about 2 minutes.

  6. Step 6

    Fold in the sliced palm hearts and green olives using a wooden spoon, lifting from the bottom of the pan and turning the mixture gently until everything is mixed, about 1 minute.

  7. Step 7

    Taste the filling with a small spoon and add a small pinch of salt and a small pinch of pepper. Stir once and taste again. Repeat until it tastes savory and well-balanced.

  8. Step 8

    Remove the pan from heat and set it aside to cool for 3 minutes so the filling is warm but not hot when you fill the pastry.

  9. Step 9

    Unfold the thawed puff pastry sheets on a work surface and lay them flat. If using two sheets, place them so they overlap by about 1 inch in the center.

  10. Step 10

    Spoon the chicken filling onto the center of the pastry sheets in a long mound, leaving a 2-inch border of empty pastry on all sides.

  11. Step 11

    Fold one long edge of pastry over the filling, then fold the opposite long edge on top, overlapping them slightly in the center like a closed envelope.

  12. Step 12

    Fold the short ends up and over the filled center, sealing them with a gentle press of your fingers so the pastry clings together.

  13. Step 13

    Place the assembled empadão seam-side down on a rimmed baking sheet lined with parchment paper.

  14. Step 14

    Slide the baking sheet into the preheated oven and bake until the pastry turns the color of warm honey and the edges just begin to look darker, about 12 minutes.

  15. Step 15

    Remove the baking sheet from the oven using oven mitts and place it on a cool stovetop or trivet.

  16. Step 16

    Let the empadão rest for 2 minutes, then slice it crosswise into 4 equal portions using a serrated knife and a gentle sawing motion.

  17. Step 17

    Transfer each slice to a plate and serve warm.

Tools you’ll need

  • oven
  • rimmed baking sheet
  • parchment paper
  • medium saucepan
  • wooden spoon
  • colander
  • cutting board
  • serrated knife
  • oven mitts

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.