Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Chicken Suprême with Roasted Vegetables

Pan-seared chicken breast in a silky cream sauce, plated with roasted potatoes, broccoli, and carrots. French elegance in 25 minutes.

Total time
25 min
Servings
2
Calories
725
Protein
48g
Creamy Chicken Suprême with Roasted Vegetables
elegantindulgentfrenchchickentendercreamycrispyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry and season both sides generously with salt and pepper.

  2. Step 2

    Toss potatoes and carrots with olive oil, salt, and pepper on a sheet pan.

  3. Step 3

    Roast potatoes and carrots at 425°F for 15 minutes while you sear the chicken.

  4. Step 4

    Heat 1 tbsp butter in a large skillet over medium-high until foaming and sizzling.

  5. Step 5

    Sear chicken 5–6 minutes per side without moving until golden and internal temperature reaches 165°F. Transfer to a plate.

  6. Step 6

    Add minced shallot to the same skillet and sauté 60 seconds until fragrant.

  7. Step 7

    Pour white wine into the pan, scraping up any browned bits, then simmer for 2 minutes.

  8. Step 8

    Stir in cream and mustard, then slide chicken back into the sauce and lower heat to medium.

  9. Step 9

    Simmer gently for 3 minutes until sauce coats the back of a spoon and chicken is heated through.

  10. Step 10

    Steam broccoli in a microwave-safe bowl with 2 tbsp water for 3 minutes until tender-crisp.

  11. Step 11

    Plate chicken, sauce, roasted vegetables, and steamed broccoli. Finish with a pinch of fleur de sel.

Tools you’ll need

  • sheet pan
  • 12-inch skillet
  • microwave-safe bowl
  • tongs
  • meat thermometer
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.