Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Chickpea Stew (Shiro Tegamino)

Ethiopian chickpea flour stew rich with garlic, ginger, and chili, finished with a silky paste and served with injera. Deeply savory, warming, and ready in under 20 minutes.

Total time
18 min
Servings
4
Calories
248
Protein
9g
Creamy Chickpea Stew (Shiro Tegamino)
comfortcozyethiopianvegetarianveganchickpeascreamysmooth

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp olive oil in a large pot over medium-high until it shimmers, ~90 seconds.

  2. Step 2

    Add minced garlic, ginger, and chili. Cook 60 seconds until fragrant, stirring constantly to avoid burning.

  3. Step 3

    Pour in water and bring to a boil. Whisk in chickpea flour slowly, breaking up lumps with the back of a spoon.

  4. Step 4

    Reduce heat to medium-low. Stir in berbere, salt, and pepper. Simmer 8–10 minutes, stirring frequently, until thickened and fragrant.

  5. Step 5

    The stew should be creamy and coat the back of a spoon. If too thick, thin with a splash of water. Taste and adjust seasoning.

  6. Step 6

    Serve hot over injera or with flatbread on the side. Drizzle with a little extra olive oil on top if desired.

Tools you’ll need

  • large pot (3–4 quart)
  • whisk
  • spoon
  • measuring cups
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.