Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Yemisir Kik with Eggs & Injera

Creamy yellow split pea stew spiked with ginger and turmeric, served with soft-boiled eggs, potatoes, and spongy injera. A weeknight version of the Ethiopian classic that's ready in 20 minutes.

Total time
20 min
Servings
2
Calories
280
Protein
16g
20-Min Yemisir Kik with Eggs & Injera
comfortwholesomeethiopianvegetarianveganchickpeascreamytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse split peas and add to a pot with 3 cups water, diced onion, minced ginger, and turmeric.

  2. Step 2

    Bring to a boil, then reduce heat and simmer 12–14 minutes until peas break down into a creamy paste.

  3. Step 3

    While the stew simmers, boil the eggs in a separate small pot for 6–7 minutes until soft-boiled.

  4. Step 4

    Season the stew with salt and pepper to taste, then stir until smooth and velvety.

  5. Step 5

    Warm injera in a dry skillet 30 seconds per side until pliable.

  6. Step 6

    Spoon stew onto injera, top with a soft-boiled egg, and serve with lime wedge.

Tools you’ll need

  • medium pot
  • small pot
  • wooden spoon
  • skillet

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.