Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Silky Chickpea Stew (Shiro)

Ethiopian chickpea flour stew with ginger, garlic, and chili heat. Creamy, savory, and ready in 25 minutes—serve with injera or flatbread.

Total time
25 min
Servings
4
Calories
220
Protein
10g
Silky Chickpea Stew (Shiro)
comfortwholesomeethiopianvegetarianveganchickpeascreamysmooth

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat olive oil in a large pot over medium. Add diced onion and sauté until soft and translucent, about 4 minutes.

  2. Step 2

    Add minced garlic and ginger, stir constantly for 60 seconds until fragrant. Add tomato paste and stir to combine.

  3. Step 3

    Whisk chickpea flour with 1 cup water until smooth with no lumps. Pour the slurry slowly into the pot, stirring constantly.

  4. Step 4

    Add remaining 1.5 cups water and hot pepper. Bring to a gentle simmer, stirring frequently to prevent lumps.

  5. Step 5

    Simmer for 8–10 minutes, stirring often, until the stew thickens and darkens to a deep golden-brown. Taste and adjust salt and spice.

  6. Step 6

    Transfer to a serving platter. Make a shallow well in the center, drizzle with olive oil. Serve hot with injera or flatbread.

Tools you’ll need

  • large pot (3+ quart)
  • whisk
  • wooden spoon or silicone spatula
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.