Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Garlic Chicken with Roasted Potatoes & Tomatoes

Pan-seared chicken breasts in a silky white wine and mustard sauce, served alongside crispy roasted potatoes and tomatoes. Restaurant-quality French comfort food ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
485
Protein
42g
Creamy Garlic Chicken with Roasted Potatoes & Tomatoes
elegantcomfortfrenchchickentendercrispycreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 425°F. Toss potatoes and tomatoes with 1 tbsp olive oil, salt, and pepper, then spread on a sheet pan.

  2. Step 2

    Roast vegetables for 18–20 minutes until potatoes are golden and tomatoes blister.

  3. Step 3

    While vegetables roast, pat chicken breasts dry and season both sides with salt and pepper.

  4. Step 4

    Heat 1 tbsp olive oil in a large skillet over medium-high until shimmering. Sear chicken 5 minutes per side without moving until golden.

  5. Step 5

    Pour wine into the skillet, add mustard and thyme, then simmer 4 minutes until sauce reduces slightly.

  6. Step 6

    Stir in cream, cook 1 minute until silky, then taste and season. Serve chicken alongside roasted vegetables.

Tools you’ll need

  • sheet pan
  • large skillet (12-inch)
  • wooden spoon
  • meat thermometer (optional but helpful)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.