CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Creamy Mango Lassi & Toast

Silky cold mango yogurt drink blended with cardamom and served with warm buttered toast. A classic Indian snack that's ready in 5 minutes.

Total time
5 min
Servings
2
Calories
245
Protein
8g
Creamy Mango Lassi & Toast
refreshingsimpleindianvegetarianyogurtcreamysmoothsnack

Ingredients

  • 2 cups fresh mango, peeled and cubed
  • 1 cup plain yogurt (full-fat or Greek)
  • ¾ cup whole milk
  • 2 tbsp granulated sugar
  • 4 whole cardamom pods, crushed
  • 2 slices bread (white, whole wheat, or brioche), sliced

Instructions

  1. 1

    Add mango, yogurt, milk, sugar, and cardamom to a blender. Blend until completely smooth, about 60 seconds.

  2. 2

    Pour into two glasses. If you prefer it thicker, add more yogurt; for thinner, add more milk.

  3. 3

    Toast the bread slices until edges are golden and crispy, about 2–3 minutes.

  4. 4

    Butter the warm toast lightly. Serve the lassi in glasses alongside the toast.

Tools you’ll need

  • blender
  • two drinking glasses
  • toaster or skillet
  • butter knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.