Creamy Mango Lassi & Toast
Silky cold mango yogurt drink blended with cardamom and served with warm buttered toast. A classic Indian snack that's ready in 5 minutes.
- Total time
- 5 min
- Servings
- 2
- Calories
- 245
- Protein
- 8g

refreshingsimpleindianvegetarianyogurtcreamysmoothsnack
Ingredients
- 2 cups fresh mango, peeled and cubed
- 1 cup plain yogurt (full-fat or Greek)
- ¾ cup whole milk
- 2 tbsp granulated sugar
- 4 whole cardamom pods, crushed
- 2 slices bread (white, whole wheat, or brioche), sliced
Instructions
- 1
Add mango, yogurt, milk, sugar, and cardamom to a blender. Blend until completely smooth, about 60 seconds.
- 2
Pour into two glasses. If you prefer it thicker, add more yogurt; for thinner, add more milk.
- 3
Toast the bread slices until edges are golden and crispy, about 2–3 minutes.
- 4
Butter the warm toast lightly. Serve the lassi in glasses alongside the toast.
Tools you’ll need
- blender
- two drinking glasses
- toaster or skillet
- butter knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



