Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Mango Lassi & Toast

Silky cold mango yogurt drink blended with cardamom and served with warm buttered toast. A classic Indian snack that's ready in 5 minutes.

Total time
5 min
Servings
2
Calories
245
Protein
8g
Creamy Mango Lassi & Toast
refreshingsimpleindianvegetarianyogurtcreamysmoothsnack

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Add mango, yogurt, milk, sugar, and cardamom to a blender. Blend until completely smooth, about 60 seconds.

  2. Step 2

    Pour into two glasses. If you prefer it thicker, add more yogurt; for thinner, add more milk.

  3. Step 3

    Toast the bread slices until edges are golden and crispy, about 2–3 minutes.

  4. Step 4

    Butter the warm toast lightly. Serve the lassi in glasses alongside the toast.

Tools you’ll need

  • blender
  • two drinking glasses
  • toaster or skillet
  • butter knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.