CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Creamy Mushroom Pasta

Tender pasta tossed with sautéed mushrooms in a silky cream sauce, finished with sharp Parmesan. Ready in under 20 minutes — the weeknight pasta that feels fancy but takes zero effort.

Total time
18 min
Servings
2
Calories
520
Protein
18g
Creamy Mushroom Pasta
comfortsimpleitalianvegetariancreamytenderweeknightpasta

Ingredients

  • 8 oz pasta (penne or fettuccine)
  • 10 oz mushrooms, sliced 1/4-inch thick
  • ¾ cup heavy cream
  • ½ cup Parmesan cheese, finely grated

Instructions

  1. 1

    Boil salted water in a large skillet, add pasta, and cook until al dente, ~9 minutes.

  2. 2

    Reserve 1/2 cup pasta water, then drain pasta and set aside.

  3. 3

    In the same skillet, sauté mushrooms over medium-high heat until golden and water evaporates, ~5 minutes.

  4. 4

    Pour in cream, stir to combine, then simmer 2 minutes until slightly thickened.

  5. 5

    Add pasta back to the skillet, toss to coat, then add pasta water a splash at a time until silky.

  6. 6

    Stir in Parmesan, season with salt and pepper, then serve immediately.

Tools you’ll need

  • large skillet with lid
  • colander
  • wooden spoon
  • grater or microplane

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.