Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Mushroom Pasta

Tender pasta tossed with sautéed mushrooms in a silky cream sauce, finished with sharp Parmesan. Ready in under 20 minutes — the weeknight pasta that feels fancy but takes zero effort.

Total time
18 min
Servings
2
Calories
520
Protein
18g
Creamy Mushroom Pasta
comfortsimpleitalianvegetariancreamytenderweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet, add pasta, and cook until al dente, ~9 minutes.

  2. Step 2

    Reserve 1/2 cup pasta water, then drain pasta and set aside.

  3. Step 3

    In the same skillet, sauté mushrooms over medium-high heat until golden and water evaporates, ~5 minutes.

  4. Step 4

    Pour in cream, stir to combine, then simmer 2 minutes until slightly thickened.

  5. Step 5

    Add pasta back to the skillet, toss to coat, then add pasta water a splash at a time until silky.

  6. Step 6

    Stir in Parmesan, season with salt and pepper, then serve immediately.

Tools you’ll need

  • large skillet with lid
  • colander
  • wooden spoon
  • grater or microplane

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.