Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Minute Creamy Spinach Pasta

Fresh spinach wilts into a silky cream cheese sauce while pasta cooks, then everything tossles with Parmesan for a restaurant-quality dinner in under 10 minutes. Serve with garlic bread for a complete meal.

Total time
10 min
Servings
2
Calories
520
Protein
22g
10-Minute Creamy Spinach Pasta
comfortquickitalianvegetariancreamytenderweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet, add pasta, and cook until al dente, ~9 minutes.

  2. Step 2

    Reserve 1 cup pasta water, then drain pasta and return it to the skillet.

  3. Step 3

    Add cream cheese, spinach, and 0.5 cup reserved pasta water to the skillet.

  4. Step 4

    Stir over medium heat until spinach wilts and sauce becomes smooth, ~2 minutes.

  5. Step 5

    Stir in Parmesan, add more pasta water if needed for creaminess, then serve.

Tools you’ll need

  • large skillet or shallow pot
  • colander
  • wooden spoon
  • measuring cup

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.