10-Minute Creamy Spinach Pasta
Fresh spinach wilts into a silky cream cheese sauce while pasta cooks, then everything tossles with Parmesan for a restaurant-quality dinner in under 10 minutes. Serve with garlic bread for a complete meal.
- Total time
- 10 min
- Servings
- 2
- Calories
- 520
- Protein
- 22g

comfortquickitalianvegetariancreamytenderweeknightpasta
Ingredients
- 8 oz pasta (penne or linguine)
- 4 cups fresh spinach
- 4 oz cream cheese
- ½ cup parmesan, grated
Instructions
- 1
Boil salted water in a large skillet, add pasta, and cook until al dente, ~9 minutes.
- 2
Reserve 1 cup pasta water, then drain pasta and return it to the skillet.
- 3
Add cream cheese, spinach, and 0.5 cup reserved pasta water to the skillet.
- 4
Stir over medium heat until spinach wilts and sauce becomes smooth, ~2 minutes.
- 5
Stir in Parmesan, add more pasta water if needed for creaminess, then serve.
Tools you’ll need
- large skillet or shallow pot
- colander
- wooden spoon
- measuring cup
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



