CookSnap is in beta — Get it free on TestFlight →
Back to recipes

10-Minute Creamy Spinach Pasta

Fresh spinach wilts into a silky cream cheese sauce while pasta cooks, then everything tossles with Parmesan for a restaurant-quality dinner in under 10 minutes. Serve with garlic bread for a complete meal.

Total time
10 min
Servings
2
Calories
520
Protein
22g
10-Minute Creamy Spinach Pasta
comfortquickitalianvegetariancreamytenderweeknightpasta

Ingredients

  • 8 oz pasta (penne or linguine)
  • 4 cups fresh spinach
  • 4 oz cream cheese
  • ½ cup parmesan, grated

Instructions

  1. 1

    Boil salted water in a large skillet, add pasta, and cook until al dente, ~9 minutes.

  2. 2

    Reserve 1 cup pasta water, then drain pasta and return it to the skillet.

  3. 3

    Add cream cheese, spinach, and 0.5 cup reserved pasta water to the skillet.

  4. 4

    Stir over medium heat until spinach wilts and sauce becomes smooth, ~2 minutes.

  5. 5

    Stir in Parmesan, add more pasta water if needed for creaminess, then serve.

Tools you’ll need

  • large skillet or shallow pot
  • colander
  • wooden spoon
  • measuring cup

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.