Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Three-Cheese Pasta

Creamy, melty pasta with a blend of mozzarella, parmesan, and sharp cheddar cheese. Ready in 15 minutes — pure comfort on a weeknight.

Total time
15 min
Servings
2
Calories
520
Protein
24g
Three-Cheese Pasta
comfortquickitalianvegetariancheesecreamymeltyweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet over high heat, then add pasta and cook until al dente, stirring occasionally.

  2. Step 2

    Reserve 1 cup pasta water, then drain the pasta and return it to the skillet off heat.

  3. Step 3

    Add all three cheeses and 0.5 cup pasta water, stirring until the cheeses melt into a creamy sauce.

  4. Step 4

    Add more pasta water a splash at a time if the sauce is too thick, stirring until silky.

  5. Step 5

    Season with salt and black pepper to taste, then serve immediately.

Tools you’ll need

  • large skillet with lid
  • wooden spoon
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.