Three-Cheese Pasta
Creamy, melty pasta with a blend of mozzarella, parmesan, and sharp cheddar cheese. Ready in 15 minutes — pure comfort on a weeknight.
- Total time
- 15 min
- Servings
- 2
- Calories
- 520
- Protein
- 24g

comfortquickitalianvegetariancheesecreamymeltyweeknight
Ingredients
- 8 oz pasta (penne or rigatoni)
- 1 cup mozzarella cheese, shredded
- ½ cup parmesan cheese, grated
- ¾ cup cheddar cheese, shredded
Instructions
- 1
Boil salted water in a large skillet over high heat, then add pasta and cook until al dente, stirring occasionally.
- 2
Reserve 1 cup pasta water, then drain the pasta and return it to the skillet off heat.
- 3
Add all three cheeses and 0.5 cup pasta water, stirring until the cheeses melt into a creamy sauce.
- 4
Add more pasta water a splash at a time if the sauce is too thick, stirring until silky.
- 5
Season with salt and black pepper to taste, then serve immediately.
Tools you’ll need
- large skillet with lid
- wooden spoon
- measuring cups
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



