CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Three-Cheese Pasta

Creamy, melty pasta with a blend of mozzarella, parmesan, and sharp cheddar cheese. Ready in 15 minutes — pure comfort on a weeknight.

Total time
15 min
Servings
2
Calories
520
Protein
24g
Three-Cheese Pasta
comfortquickitalianvegetariancheesecreamymeltyweeknight

Ingredients

  • 8 oz pasta (penne or rigatoni)
  • 1 cup mozzarella cheese, shredded
  • ½ cup parmesan cheese, grated
  • ¾ cup cheddar cheese, shredded

Instructions

  1. 1

    Boil salted water in a large skillet over high heat, then add pasta and cook until al dente, stirring occasionally.

  2. 2

    Reserve 1 cup pasta water, then drain the pasta and return it to the skillet off heat.

  3. 3

    Add all three cheeses and 0.5 cup pasta water, stirring until the cheeses melt into a creamy sauce.

  4. 4

    Add more pasta water a splash at a time if the sauce is too thick, stirring until silky.

  5. 5

    Season with salt and black pepper to taste, then serve immediately.

Tools you’ll need

  • large skillet with lid
  • wooden spoon
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.