CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Min Penne Alla Vodka

Creamy tomato pasta made with marinara, cream, and parmesan—ready in under 5 minutes. No vodka required; the sauce is silky and satisfying as-is.

Total time
15 min
Servings
2
Calories
520
Protein
18g
15-Min Penne Alla Vodka
comfortquickitalianvegetariancreamytenderweeknightpasta

Ingredients

  • 8 oz penne
  • 1 cup marinara sauce
  • ½ cup heavy cream
  • ½ cup parmesan cheese, grated

Instructions

  1. 1

    Boil penne in salted water until al dente, about 9 minutes.

  2. 2

    Pour marinara and cream into a large skillet over medium heat.

  3. 3

    Stir constantly until the sauce is smooth and just beginning to bubble, ~2 minutes.

  4. 4

    Drain pasta, reserving 1/4 cup pasta water, then add to the skillet.

  5. 5

    Toss gently until coated; add pasta water if needed to loosen the sauce.

  6. 6

    Remove from heat, stir in parmesan, and serve immediately.

Tools you’ll need

  • large pot for pasta water
  • large skillet or sauté pan
  • wooden spoon or silicone spatula
  • colander
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.