Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Penne Alla Vodka

Creamy tomato pasta made with marinara, cream, and parmesan—ready in under 5 minutes. No vodka required; the sauce is silky and satisfying as-is.

Total time
15 min
Servings
2
Calories
520
Protein
18g
15-Min Penne Alla Vodka
comfortquickitalianvegetariancreamytenderweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil penne in salted water until al dente, about 9 minutes.

  2. Step 2

    Pour marinara and cream into a large skillet over medium heat.

  3. Step 3

    Stir constantly until the sauce is smooth and just beginning to bubble, ~2 minutes.

  4. Step 4

    Drain pasta, reserving 1/4 cup pasta water, then add to the skillet.

  5. Step 5

    Toss gently until coated; add pasta water if needed to loosen the sauce.

  6. Step 6

    Remove from heat, stir in parmesan, and serve immediately.

Tools you’ll need

  • large pot for pasta water
  • large skillet or sauté pan
  • wooden spoon or silicone spatula
  • colander
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.