Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Tomato Spinach Pasta

A silky one-pot pasta where garlic-infused cream mingles with tomatoes and fresh spinach. Ready in under 20 minutes, no draining required.

Total time
18 min
Servings
2
Calories
485
Protein
13g
Creamy Tomato Spinach Pasta
comfortsimpleitalianvegetariancreamytenderweeknightpasta

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat olive oil in a large skillet over medium-high heat until shimmering, about 1 minute.

  2. Step 2

    Add minced garlic and cook, stirring, for 30 seconds until fragrant.

  3. Step 3

    Pour in the diced tomatoes and 1.5 cups water, then add pasta and a pinch of salt.

  4. Step 4

    Bring to a boil, then simmer for 10 minutes, stirring occasionally, until pasta is almost tender.

  5. Step 5

    Stir in heavy cream and spinach, cooking for 2 minutes until spinach wilts and sauce thickens.

  6. Step 6

    Taste and adjust salt and pepper, then serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.