Back to recipes
Tomato Cream Tortellini
Silky cream-tomato sauce coats tender tortellini in under 20 minutes—no fancy technique required. Pure comfort in a bowl.
- Total time
- 18 min
- Servings
- 2
- Calories
- 520
- Protein
- 18g
comfortsimpleitalianvegetariancreamytenderweeknightpasta
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Boil salted water in a large skillet, then add tortellini and cook until they float plus 1 minute more.
Step 2
Pour canned tomatoes directly into the skillet with the tortellini, breaking up any large chunks.
Step 3
Stir in cream and simmer for 3 minutes until the sauce coats the back of a spoon.
Step 4
Season with salt and pepper to taste, then serve immediately.
Tools you’ll need
- large skillet (12-inch)
- wooden spoon
- measuring cup
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
