Tomato Cream Tortellini
Silky cream-tomato sauce coats tender tortellini in under 20 minutes—no fancy technique required. Pure comfort in a bowl.
- Total time
- 18 min
- Servings
- 2
- Calories
- 520
- Protein
- 18g

comfortsimpleitalianvegetariancreamytenderweeknightpasta
Ingredients
- 1 lb tortellini
- 1 can (14.5 oz) canned tomatoes
- ½ cup heavy cream
Instructions
- 1
Boil salted water in a large skillet, then add tortellini and cook until they float plus 1 minute more.
- 2
Pour canned tomatoes directly into the skillet with the tortellini, breaking up any large chunks.
- 3
Stir in cream and simmer for 3 minutes until the sauce coats the back of a spoon.
- 4
Season with salt and pepper to taste, then serve immediately.
Tools you’ll need
- large skillet (12-inch)
- wooden spoon
- measuring cup
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



