Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Apple-Cheese Strudel

Hungarian-inspired apple strudel with cottage cheese, baked until golden in under 30 minutes. Warm, sweet, and utterly craveable—the TikTok version of meggyes rétes.

Total time
25 min
Servings
4
Calories
285
Protein
8g
Crispy Apple-Cheese Strudel
comfortcozyhungarianvegetariancrispytendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel and slice apples into thin matchsticks. Toss with 2 tbsp sugar, cinnamon, and raisins.

  2. Step 2

    Mix cottage cheese with 1 tbsp sugar until combined.

  3. Step 3

    Lay one phyllo sheet on a work surface. Brush lightly with melted butter. Layer two more sheets, brushing each.

  4. Step 4

    Spread half the cottage cheese along the long edge, leaving a 2-inch border. Top with half the apple mixture.

  5. Step 5

    Roll tightly from the filled edge, tucking in the sides as you go. Transfer seam-side down to a parchment-lined baking sheet.

  6. Step 6

    Repeat with remaining phyllo, butter, cheese, and apples. Brush both rolls with remaining butter.

  7. Step 7

    Bake at 400°F until golden brown, about 12–15 minutes. Serve warm, dusted with powdered sugar if desired.

Tools you’ll need

  • parchment paper
  • work surface
  • pastry brush
  • large baking sheet
  • oven
  • peeler
  • sharp knife
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.