Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Cinnamon Sugar Spiral Pastry

A TikTok-easy riff on Hungarian kürtőskalács: spiral-wound puff pastry rolled in cinnamon sugar, then baked until golden and crispy. Sweet, buttery, ready in under 15 minutes.

Total time
15 min
Servings
4
Calories
285
Protein
3g
10-Min Cinnamon Sugar Spiral Pastry
indulgentcasualhungarianvegetariancrispyflakytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Thaw puff pastry at room temperature for 5 minutes.

  2. Step 2

    Mix cinnamon and granulated sugar in a small bowl. Brush both pastry sheets with melted butter, then vanilla extract.

  3. Step 3

    Sprinkle cinnamon-sugar mixture evenly over the buttered pastry. Press gently so it sticks.

  4. Step 4

    Starting at one short end, tightly roll each pastry sheet into a log. Slice each log into 4 spirals (8 total).

  5. Step 5

    Place spirals cut-side up on a parchment-lined baking sheet. Sprinkle with coarse sugar and a pinch of salt if using.

  6. Step 6

    Bake until golden brown and crispy, 10–12 minutes. Serve warm.

Tools you’ll need

  • oven
  • parchment paper
  • baking sheet
  • small bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.