Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Butter Galettes

Thin, crispy French butter cookies that shatter in your mouth—baked on a sheet pan in under 20 minutes. No mixer needed, just butter, sugar, flour, and eggs.

Total time
18 min
Servings
4
Calories
280
Protein
3g
Crispy Butter Galettes
indulgentsimplefrenchvegetariancrispyflakyweeknightdessert

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cream butter and sugar together in a bowl until pale and fluffy, about 2 minutes.

  2. Step 2

    Stir in the egg yolk until combined, then fold in flour and salt until a dough just comes together.

  3. Step 3

    Roll dough between two sheets of parchment into a thin 1/8-inch rectangle, then chill 5 minutes.

  4. Step 4

    Cut into 2-inch squares, place on a parchment-lined sheet pan, and brush the tops with beaten egg white.

  5. Step 5

    Sprinkle a tiny pinch of fleur de sel on each square, then bake at 375°F for 8–10 minutes until golden.

  6. Step 6

    Cool on the pan 2 minutes, then transfer to a wire rack to crisp up completely.

Tools you’ll need

  • mixing bowl
  • spoon
  • rolling pin
  • parchment paper
  • sheet pan
  • pastry brush
  • wire cooling rack

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.