CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Butter Galettes with Caramelized Onions

Paper-thin French crêpes crisped in butter until golden, topped with sweet caramelized onions and sharp Gruyère. Ready in under 20 minutes—the TikTok version of a Breton classic.

Total time
22 min
Servings
2
Calories
425
Protein
16g
Crispy Butter Galettes with Caramelized Onions
elegantsimplefrenchvegetarianvegetariancrispytendercreamy

Ingredients

  • ¾ cup all-purpose flour
  • 2 whole eggs
  • 1 cup whole milk
  • 2 medium, sliced thin yellow onions
  • ¾ cup Gruyère cheese, grated
  • 4 tbsp, divided butter
  • ½ tsp granulated sugar
  • 2 sprigs fresh thyme

Instructions

  1. 1

    Whisk flour, eggs, milk, and a pinch of salt until smooth. Let rest 5 minutes while you prep the onions.

  2. 2

    Melt 2 tbsp butter in a large skillet over medium. Add onions, sugar, and thyme. Stir often until deep golden, ~10 minutes.

  3. 3

    Transfer onions to a plate. Wipe skillet clean with paper towel and return to medium heat.

  4. 4

    Melt remaining 2 tbsp butter in the skillet. Pour in 1/4 cup batter, tilting immediately to spread thin as a crêpe, ~30 seconds.

  5. 5

    When edges look set and bottom is pale golden, flip. Top with a handful of Gruyère and caramelized onions, then fold into quarters.

  6. 6

    Cook 60 more seconds until cheese melts. Transfer to a plate. Repeat with remaining batter. Serve hot.

Tools you’ll need

  • 10-inch non-stick or cast-iron skillet
  • whisk
  • spatula
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.