Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Butter Galettes with Caramelized Onions

Paper-thin French crêpes crisped in butter until golden, topped with sweet caramelized onions and sharp Gruyère. Ready in under 20 minutes—the TikTok version of a Breton classic.

Total time
22 min
Servings
2
Calories
425
Protein
16g
Crispy Butter Galettes with Caramelized Onions
elegantsimplefrenchvegetarianvegetariancrispytendercreamy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour, eggs, milk, and a pinch of salt until smooth. Let rest 5 minutes while you prep the onions.

  2. Step 2

    Melt 2 tbsp butter in a large skillet over medium. Add onions, sugar, and thyme. Stir often until deep golden, ~10 minutes.

  3. Step 3

    Transfer onions to a plate. Wipe skillet clean with paper towel and return to medium heat.

  4. Step 4

    Melt remaining 2 tbsp butter in the skillet. Pour in 1/4 cup batter, tilting immediately to spread thin as a crêpe, ~30 seconds.

  5. Step 5

    When edges look set and bottom is pale golden, flip. Top with a handful of Gruyère and caramelized onions, then fold into quarters.

  6. Step 6

    Cook 60 more seconds until cheese melts. Transfer to a plate. Repeat with remaining batter. Serve hot.

Tools you’ll need

  • 10-inch non-stick or cast-iron skillet
  • whisk
  • spatula
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.