Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Carrot Fritters with Honey

Golden, crunchy fritters made from shredded carrot, egg, and flour, pan-fried until crispy. Serve with honey and carrot jam for dipping—sweet, savory, and ready in 20 minutes.

Total time
20 min
Servings
2
Calories
215
Protein
4g
Crispy Carrot Fritters with Honey
comfortsimpleamericanvegetariancrispytenderweeknightappetizer

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Shred the carrot into a clean kitchen towel, wrap tightly, and squeeze out as much liquid as possible.

  2. Step 2

    Mix the squeezed carrot, egg, flour, and scallion in a bowl with a pinch of salt until combined.

  3. Step 3

    Heat 2 tbsp oil in a 10-inch skillet over medium-high until it shimmers, about 60 seconds.

  4. Step 4

    Drop spoonfuls of batter into the oil and flatten each with the back of a spoon into a thin disk.

  5. Step 5

    Fry 2 to 3 minutes per side until deep golden brown and crispy at the edges.

  6. Step 6

    Transfer to a paper towel and serve warm with honey and carrot jam for dipping.

Tools you’ll need

  • box grater or microplane
  • clean kitchen towel
  • medium bowl
  • 10-inch skillet
  • slotted spatula
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.