CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Carrot Fritters with Honey

Golden, crunchy fritters made from shredded carrot, egg, and flour, pan-fried until crispy. Serve with honey and carrot jam for dipping—sweet, savory, and ready in 20 minutes.

Total time
20 min
Servings
2
Calories
215
Protein
4g
Crispy Carrot Fritters with Honey
comfortsimpleamericanvegetariancrispytenderweeknightappetizer

Ingredients

  • 3 medium carrot, peeled
  • 1 large egg
  • ¼ cup flour
  • 2 stalks scallion, sliced thin
  • 3 tbsp honey
  • 3 tbsp carrot jam

Instructions

  1. 1

    Shred the carrot into a clean kitchen towel, wrap tightly, and squeeze out as much liquid as possible.

  2. 2

    Mix the squeezed carrot, egg, flour, and scallion in a bowl with a pinch of salt until combined.

  3. 3

    Heat 2 tbsp oil in a 10-inch skillet over medium-high until it shimmers, about 60 seconds.

  4. 4

    Drop spoonfuls of batter into the oil and flatten each with the back of a spoon into a thin disk.

  5. 5

    Fry 2 to 3 minutes per side until deep golden brown and crispy at the edges.

  6. 6

    Transfer to a paper towel and serve warm with honey and carrot jam for dipping.

Tools you’ll need

  • box grater or microplane
  • clean kitchen towel
  • medium bowl
  • 10-inch skillet
  • slotted spatula
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.