Crispy Cheddar Toast with Tomatoes
Open-face cheese toast with melted cheddar and fresh tomato slices. Buttery, golden, and ready in under 10 minutes.
- Total time
- 8 min
- Servings
- 2
- Calories
- 385
- Protein
- 14g

simplecomfortamericanvegetariancheesecrispymeltyweeknight
Ingredients
- 4 slices bread (such as sourdough or white), sliced
- 2 tbsp butter
- 1 cup cheddar cheese, shredded
- 1 medium tomato, sliced
Instructions
- 1
Arrange bread slices on a baking sheet and broil 6 inches from the heat for 2–3 minutes until light golden.
- 2
Remove from broiler and spread butter evenly on each slice while still warm.
- 3
Top each slice with a handful of cheddar cheese, spreading it to the edges.
- 4
Broil again for 2–3 minutes until cheese is melted and bubbling at the edges.
- 5
Arrange tomato slices on top of each toast and season with salt and pepper.
- 6
Serve immediately while cheese is still gooey.
Tools you’ll need
- baking sheet
- broiler or oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



