Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheddar Toast with Tomatoes

Open-face cheese toast with melted cheddar and fresh tomato slices. Buttery, golden, and ready in under 10 minutes.

Total time
8 min
Servings
2
Calories
385
Protein
14g
Crispy Cheddar Toast with Tomatoes
simplecomfortamericanvegetariancheesecrispymeltyweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Arrange bread slices on a baking sheet and broil 6 inches from the heat for 2–3 minutes until light golden.

  2. Step 2

    Remove from broiler and spread butter evenly on each slice while still warm.

  3. Step 3

    Top each slice with a handful of cheddar cheese, spreading it to the edges.

  4. Step 4

    Broil again for 2–3 minutes until cheese is melted and bubbling at the edges.

  5. Step 5

    Arrange tomato slices on top of each toast and season with salt and pepper.

  6. Step 6

    Serve immediately while cheese is still gooey.

Tools you’ll need

  • baking sheet
  • broiler or oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.