CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Cheddar Toast with Tomatoes

Open-face cheese toast with melted cheddar and fresh tomato slices. Buttery, golden, and ready in under 10 minutes.

Total time
8 min
Servings
2
Calories
385
Protein
14g
Crispy Cheddar Toast with Tomatoes
simplecomfortamericanvegetariancheesecrispymeltyweeknight

Ingredients

  • 4 slices bread (such as sourdough or white), sliced
  • 2 tbsp butter
  • 1 cup cheddar cheese, shredded
  • 1 medium tomato, sliced

Instructions

  1. 1

    Arrange bread slices on a baking sheet and broil 6 inches from the heat for 2–3 minutes until light golden.

  2. 2

    Remove from broiler and spread butter evenly on each slice while still warm.

  3. 3

    Top each slice with a handful of cheddar cheese, spreading it to the edges.

  4. 4

    Broil again for 2–3 minutes until cheese is melted and bubbling at the edges.

  5. 5

    Arrange tomato slices on top of each toast and season with salt and pepper.

  6. 6

    Serve immediately while cheese is still gooey.

Tools you’ll need

  • baking sheet
  • broiler or oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.