Back to recipes
5-Min Pizza Toast
Sliced bread topped with pizza sauce and melted mozzarella — a crispy-edged, cheesy breakfast that tastes like pizza in under 5 minutes. Broil or toast until the cheese bubbles and browns.
- Total time
- 5 min
- Servings
- 2
- Calories
- 285
- Protein
- 12g
quicksimpleamericanvegetariancrispymeltyweeknightbreakfast
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Arrange bread slices on a baking sheet and broil for 90 seconds until lightly toasted.
Step 2
Spread 2 tbsp pizza sauce evenly on each slice, then top with a handful of mozzarella.
Step 3
Broil for 2–3 minutes until cheese bubbles and edges brown slightly; watch it closely.
Step 4
Serve hot straight from the broiler.
Tools you’ll need
- baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
