Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Cheese Künefe with Almonds

Shredded phyllo crisps up golden in a skillet, then gets layered with melted white cheese and drenched in warm honey-lemon syrup. Topped with crushed almonds for crunch.

Total time
15 min
Servings
2
Calories
520
Protein
12g
15-Min Crispy Cheese Künefe with Almonds
indulgentsimpleturkishvegetariancheesecrispymeltycrunchy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp butter in a 10-inch skillet over medium-high until foaming, ~90 seconds.

  2. Step 2

    Add shredded phyllo, tossing constantly with a wooden spoon until golden and crispy, 4–5 minutes.

  3. Step 3

    Sprinkle crumbled cheese evenly over the phyllo, then drizzle remaining 2 tbsp butter on top.

  4. Step 4

    Cover skillet and reduce heat to low until cheese melts, 2–3 minutes. Don't stir.

  5. Step 5

    While cheese melts, warm honey and lemon juice together in a small saucepan or microwave bowl, 90 seconds.

  6. Step 6

    Pour warm honey-lemon syrup over melted künefe, sprinkle with chopped almonds, and serve immediately.

Tools you’ll need

  • 10-inch skillet with lid
  • wooden spoon
  • small saucepan or microwave-safe bowl
  • cutting board (for chopping almonds)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.