CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Min Crispy Cheese Künefe with Almonds

Shredded phyllo crisps up golden in a skillet, then gets layered with melted white cheese and drenched in warm honey-lemon syrup. Topped with crushed almonds for crunch.

Total time
15 min
Servings
2
Calories
520
Protein
12g
15-Min Crispy Cheese Künefe with Almonds
indulgentsimpleturkishvegetariancheesecrispymeltycrunchy

Ingredients

  • 2 cups shredded phyllo dough (or filo)
  • 1 cup white cheese (feta, mozzarella, or white cheddar, crumbled)
  • 4 tbsp butter
  • ½ cup honey
  • 1 tbsp lemon juice
  • ¼ cup almonds (chopped or slivered)

Instructions

  1. 1

    Heat 2 tbsp butter in a 10-inch skillet over medium-high until foaming, ~90 seconds.

  2. 2

    Add shredded phyllo, tossing constantly with a wooden spoon until golden and crispy, 4–5 minutes.

  3. 3

    Sprinkle crumbled cheese evenly over the phyllo, then drizzle remaining 2 tbsp butter on top.

  4. 4

    Cover skillet and reduce heat to low until cheese melts, 2–3 minutes. Don't stir.

  5. 5

    While cheese melts, warm honey and lemon juice together in a small saucepan or microwave bowl, 90 seconds.

  6. 6

    Pour warm honey-lemon syrup over melted künefe, sprinkle with chopped almonds, and serve immediately.

Tools you’ll need

  • 10-inch skillet with lid
  • wooden spoon
  • small saucepan or microwave-safe bowl
  • cutting board (for chopping almonds)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.