CookSnap is in beta — Get it free on TestFlight →
Back to recipes

5-Min Crispy Künefe with Fresh Fruit

Shredded phyllo crisped in butter, layered with melted cheese, then soaked in warm honey syrup and topped with pistachios and fresh berries. Pure indulgence in under 5 minutes.

Total time
5 min
Servings
2
Calories
620
Protein
14g
5-Min Crispy Künefe with Fresh Fruit
indulgentsimpleturkishvegetariancheesecrispymeltycrunchy

Ingredients

  • 200 g shredded phyllo (künefe dough) or thin crispy noodle pastry
  • 4 tbsp butter
  • 150 g white cheese (mozzarella, halloumi, or feta), crumbled or sliced
  • ½ cup honey
  • ¼ cup roasted pistachios, roughly chopped
  • 1.5 cups fresh strawberries and bananas, sliced

Instructions

  1. 1

    Heat butter in an 8-inch skillet over medium-high until foaming, ~60 seconds.

  2. 2

    Add shredded phyllo and toss until golden brown and crispy, ~2 minutes. Press into a round nest.

  3. 3

    Scatter crumbled cheese evenly over the phyllo, press gently, then cover with a lid for 30 seconds until melted.

  4. 4

    Warm honey in a small saucepan or microwave (30 seconds) until pourable. Drizzle over the hot cheese.

  5. 5

    Slide onto a plate and top with chopped pistachios, sliced strawberries, and banana slices.

  6. 6

    Serve immediately while the cheese is still melting and the phyllo is crackling crispy.

Tools you’ll need

  • 8-inch nonstick or cast iron skillet
  • small saucepan or microwave-safe bowl
  • lid or plate to cover skillet
  • knife for slicing fruit

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.