Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Min Crispy Künefe with Fresh Fruit

Shredded phyllo crisped in butter, layered with melted cheese, then soaked in warm honey syrup and topped with pistachios and fresh berries. Pure indulgence in under 5 minutes.

Total time
5 min
Servings
2
Calories
620
Protein
14g
5-Min Crispy Künefe with Fresh Fruit
indulgentsimpleturkishvegetariancheesecrispymeltycrunchy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat butter in an 8-inch skillet over medium-high until foaming, ~60 seconds.

  2. Step 2

    Add shredded phyllo and toss until golden brown and crispy, ~2 minutes. Press into a round nest.

  3. Step 3

    Scatter crumbled cheese evenly over the phyllo, press gently, then cover with a lid for 30 seconds until melted.

  4. Step 4

    Warm honey in a small saucepan or microwave (30 seconds) until pourable. Drizzle over the hot cheese.

  5. Step 5

    Slide onto a plate and top with chopped pistachios, sliced strawberries, and banana slices.

  6. Step 6

    Serve immediately while the cheese is still melting and the phyllo is crackling crispy.

Tools you’ll need

  • 8-inch nonstick or cast iron skillet
  • small saucepan or microwave-safe bowl
  • lid or plate to cover skillet
  • knife for slicing fruit

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.