Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Cheese Kunefe with Fresh Fruit

Shredded phyllo crisped in butter with melted white cheese, drowned in cool simple syrup, topped with pistachios and a cold milk pour. Served alongside fresh watermelon, melon, and peaches for a sweet, crunchy, juicy contrast.

Total time
15 min
Servings
2
Calories
520
Protein
12g
15-Min Crispy Cheese Kunefe with Fresh Fruit
indulgentsimpleturkishvegetariancheesecrispymeltycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat butter in a 10-inch skillet over medium-high until foaming, about 60 seconds.

  2. Step 2

    Add shredded phyllo, stirring constantly, until golden and crispy, about 5 minutes.

  3. Step 3

    Scatter crumbled cheese over the phyllo and stir until starting to melt, 90 seconds.

  4. Step 4

    Slide onto a serving plate and immediately pour cool syrup over the top.

  5. Step 5

    Top with chopped pistachios. Arrange fresh fruit on the side of the plate.

  6. Step 6

    Pour cold milk over the kunefe just before eating and serve immediately.

Tools you’ll need

  • 10-inch skillet
  • wooden spoon
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.