Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheese Quesadilla Triangles

Melted cheddar tucked into tortilla triangles, pan-fried until golden and crispy. Serve with salsa, guac, and fresh veggies for dipping.

Total time
10 min
Servings
2
Calories
340
Protein
12g
Crispy Cheese Quesadilla Triangles
quickcasualamericanvegetariancheesecrispymeltysnack

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Lay one tortilla flat and scatter half the cheddar over one half of the disk.

  2. Step 2

    Fold the tortilla in half, then cut into two triangles.

  3. Step 3

    Repeat with the second tortilla and remaining cheese to make 4 triangles total.

  4. Step 4

    Heat oil in a skillet over medium-high until shimmering, about 60 seconds.

  5. Step 5

    Pan-fry triangles 2–3 minutes per side until cheese melts and tortilla turns golden.

  6. Step 6

    Serve hot with salsa, guacamole, and fresh peppers and tomatoes for dipping.

Tools you’ll need

  • cutting board
  • knife
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.