Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheese & Spinach Quesadilla

Golden, melty quesadilla stuffed with wilted spinach, bell pepper, and mozzarella—ready in 10 minutes. Serve with fries and salsa for the full plate.

Total time
10 min
Servings
2
Calories
420
Protein
14g
Crispy Cheese & Spinach Quesadilla
quickcasualmexicanvegetariancheesecrispymeltyweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tablespoon oil in a skillet over medium-high. Add bell pepper and cook 2 minutes, stirring occasionally, until slightly soft.

  2. Step 2

    Add spinach and cook 60 seconds, stirring, until wilted. Transfer to a plate.

  3. Step 3

    Lay one tortilla on the skillet. Sprinkle half the cheese, then the spinach-pepper mixture, then the remaining cheese.

  4. Step 4

    Top with the second tortilla. Cook 2–3 minutes until the bottom is golden brown, then flip carefully.

  5. Step 5

    Cook the other side 1–2 minutes until golden and cheese is fully melted inside.

  6. Step 6

    Slide onto a cutting board, cut into wedges, and serve with fries and salsa.

Tools you’ll need

  • 10-inch skillet
  • spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.