CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Cheese & Spinach Quesadilla

Golden, melty quesadilla stuffed with wilted spinach, bell pepper, and mozzarella—ready in 10 minutes. Serve with fries and salsa for the full plate.

Total time
10 min
Servings
2
Calories
420
Protein
14g
Crispy Cheese & Spinach Quesadilla
quickcasualmexicanvegetariancheesecrispymeltyweeknight

Ingredients

  • 2 large (10-inch) tortillas
  • 1 cup, packed fresh spinach
  • ½ pepper, diced bell pepper (any color)
  • ¾ cup mozzarella cheese, shredded

Instructions

  1. 1

    Heat 1 tablespoon oil in a skillet over medium-high. Add bell pepper and cook 2 minutes, stirring occasionally, until slightly soft.

  2. 2

    Add spinach and cook 60 seconds, stirring, until wilted. Transfer to a plate.

  3. 3

    Lay one tortilla on the skillet. Sprinkle half the cheese, then the spinach-pepper mixture, then the remaining cheese.

  4. 4

    Top with the second tortilla. Cook 2–3 minutes until the bottom is golden brown, then flip carefully.

  5. 5

    Cook the other side 1–2 minutes until golden and cheese is fully melted inside.

  6. 6

    Slide onto a cutting board, cut into wedges, and serve with fries and salsa.

Tools you’ll need

  • 10-inch skillet
  • spatula
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.