Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Melty Spinach Quesadilla

Crispy tortilla stuffed with wilted spinach and melted mozzarella. Serve with sour cream and pico de gallo for a weeknight meal that tastes restaurant-quality.

Total time
12 min
Servings
2
Calories
385
Protein
14g
Melty Spinach Quesadilla
casualquickamericanmexicanvegetariancrispymeltyweeknight

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a large skillet over medium-high until a drop of water sizzles on contact, ~90 seconds.

  2. Step 2

    Add spinach to the skillet and stir until completely wilted and any excess water evaporates, ~2 minutes.

  3. Step 3

    Lay one tortilla on a plate, spread half the spinach on one half, top with half the mozzarella.

  4. Step 4

    Fold tortilla in half and slide onto the skillet, cooking until edges are golden and cheese melts, ~3 minutes per side.

  5. Step 5

    Repeat with remaining tortillas, spinach, and cheese.

  6. Step 6

    Serve hot with sour cream and pico de gallo on the side.

Tools you’ll need

  • 12-inch skillet
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.