Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheese & Tomato Quesadillas

Melted cheddar and fresh tomato in a golden, crispy tortilla. Serve with red onions, salsa, and sour cream on the side for a weeknight dinner that tastes like a taco truck.

Total time
10 min
Servings
2
Calories
320
Protein
12g
Crispy Cheese & Tomato Quesadillas
casualquickmexicanvegetariancrispymeltyweeknightquesadilla

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a skillet over medium-high until a drop of water sizzles on contact, ~90 seconds.

  2. Step 2

    Lay one tortilla in the skillet, sprinkle half with cheese and tomato, fold in half.

  3. Step 3

    Cook 2 minutes per side until the tortilla is golden and crispy, cheese melted inside.

  4. Step 4

    Slide onto a plate and repeat with remaining tortillas, cheese, and tomato.

  5. Step 5

    Serve with red onion, salsa, and sour cream alongside.

Tools you’ll need

  • 12-inch skillet or larger
  • spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.