Crispy Cheese & Tomato Quesadillas
Melted cheddar and fresh tomato in a golden, crispy tortilla. Serve with red onions, salsa, and sour cream on the side for a weeknight dinner that tastes like a taco truck.
- Total time
- 10 min
- Servings
- 2
- Calories
- 320
- Protein
- 12g

casualquickmexicanvegetariancrispymeltyweeknightquesadilla
Ingredients
- 4 4-inch tortillas flour tortillas
- 1 cup cheddar cheese, shredded
- 1 medium tomato tomato, diced
Instructions
- 1
Heat a skillet over medium-high until a drop of water sizzles on contact, ~90 seconds.
- 2
Lay one tortilla in the skillet, sprinkle half with cheese and tomato, fold in half.
- 3
Cook 2 minutes per side until the tortilla is golden and crispy, cheese melted inside.
- 4
Slide onto a plate and repeat with remaining tortillas, cheese, and tomato.
- 5
Serve with red onion, salsa, and sour cream alongside.
Tools you’ll need
- 12-inch skillet or larger
- spatula
- cutting board
- knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



