CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Cheese & Tomato Quesadillas

Melted cheddar and fresh tomato in a golden, crispy tortilla. Serve with red onions, salsa, and sour cream on the side for a weeknight dinner that tastes like a taco truck.

Total time
10 min
Servings
2
Calories
320
Protein
12g
Crispy Cheese & Tomato Quesadillas
casualquickmexicanvegetariancrispymeltyweeknightquesadilla

Ingredients

  • 4 4-inch tortillas flour tortillas
  • 1 cup cheddar cheese, shredded
  • 1 medium tomato tomato, diced

Instructions

  1. 1

    Heat a skillet over medium-high until a drop of water sizzles on contact, ~90 seconds.

  2. 2

    Lay one tortilla in the skillet, sprinkle half with cheese and tomato, fold in half.

  3. 3

    Cook 2 minutes per side until the tortilla is golden and crispy, cheese melted inside.

  4. 4

    Slide onto a plate and repeat with remaining tortillas, cheese, and tomato.

  5. 5

    Serve with red onion, salsa, and sour cream alongside.

Tools you’ll need

  • 12-inch skillet or larger
  • spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.