Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cornmeal Catfish with Tomato & Lettuce

Golden, crunchy catfish nuggets dusted in seasoned cornmeal, fried until the edges crackle. Serve with fresh tomato and lettuce for a Southern snack that tastes like a coastal dive bar.

Total time
12 min
Servings
2
Calories
385
Protein
32g
Crispy Cornmeal Catfish with Tomato & Lettuce
casualsatisfyingsouthernfishcrispytenderweeknightcasual

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut catfish into 2-inch nuggets. Mix cornmeal, flour, cajun seasoning, salt, and pepper in a shallow bowl.

  2. Step 2

    Pat catfish nuggets dry with paper towels. Coat each piece thoroughly in the cornmeal mixture.

  3. Step 3

    Heat 0.5 inch of neutral oil in a 10-inch skillet over medium-high until it shimmers, about 2 minutes.

  4. Step 4

    Working in batches, fry nuggets until golden brown and crispy, 2–3 minutes per side. Don't crowd the pan.

  5. Step 5

    Transfer cooked nuggets to a paper-towel-lined plate. Season lightly with salt while hot.

  6. Step 6

    Arrange tomato slices and lettuce on a plate. Pile warm catfish nuggets on top and serve immediately.

Tools you’ll need

  • 10-inch skillet
  • shallow bowl
  • paper towels
  • slotted spoon or spider strainer
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.