Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Dolmades with Lemon

Jarred grape leaves stuffed with herbed rice and pan-fried until crispy—no steaming required. Squeeze fresh lemon over warm dolmades for bright, briny, totally craveable Greek comfort.

Total time
15 min
Servings
2
Calories
280
Protein
6g
15-Min Crispy Dolmades with Lemon
comfortsimplegreekvegetarianvegandairy-freevegetariancrispy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Drain and rinse grape leaves gently. Combine rice, dill, parsley, lemon zest, and half the lemon juice in a bowl.

  2. Step 2

    Place one leaf flat, shiny-side down. Add 1 tbsp rice mixture to the center, fold in sides, roll tight.

  3. Step 3

    Heat olive oil in a skillet over medium-high until shimmer appears, about 90 seconds.

  4. Step 4

    Pan-fry dolmades seam-side down in batches, 2–3 minutes per side until golden and crispy.

  5. Step 5

    Transfer to a plate. Squeeze remaining lemon juice over warm dolmades.

  6. Step 6

    Serve hot with lemon wedges on the side.

Tools you’ll need

  • medium bowl
  • 12-inch skillet
  • cutting board
  • lemon juicer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.