Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Farro & Roasted Veggie Bowl

Nutty farro tossed with charred tomatoes, zucchini, and bell peppers, finished with garlicky olive oil and fresh basil. A warm, hearty Italian bowl that's ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
385
Protein
12g
Crispy Farro & Roasted Veggie Bowl
wholesomesatisfyingitalianvegetarianvegetarianchewycrispytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil farro in salted water for 20 minutes until tender but still chewy. Drain and set aside.

  2. Step 2

    While farro cooks, toss zucchini, bell pepper, and tomatoes with 2 tbsp olive oil and a pinch of salt.

  3. Step 3

    Spread vegetables on a sheet pan and roast at 425°F for 12 minutes, stirring halfway through, until charred at edges.

  4. Step 4

    Heat remaining 2 tbsp olive oil in a small skillet over medium heat. Add minced garlic and cook 30 seconds until fragrant.

  5. Step 5

    Toss cooked farro with roasted vegetables, garlic oil, and half the fresh basil. Season with salt and pepper to taste.

  6. Step 6

    Divide into bowls and top with remaining basil. Serve warm.

Tools you’ll need

  • large pot
  • sheet pan
  • small skillet
  • cutting board
  • chef's knife
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.